Bovine Growth Hormone
Slide this table
Cat-Nr. | 500-009 |
Size | 500 µg |
Price | 390 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
Length [aa] | 191 |
Molecular Weight | 21.8 kDa |
N Terminal Sequence | AFPAM |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Recombinant bovine growth hormone is fully biologically active when compared to WHO reference standard using in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. Recombinant bovine growth hormone is also capable of forming a 1:2 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD). |
Species Reactivity | Bovine |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant bovine growth hormone in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg recombinant bovine growth hormone per ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar. |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Description | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. |
Protein Sequence | AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF |
Uniprot ID | P01246 |
Protein RefSeq | NP_851339.1 |
mRNA RefSeq | NM_180996.1 |
All prices plus VAT + possible delivery charges