Bovine FGF-21
Slide this table
| Cat-Nr. | 500-003 |
| Size | 50 µg |
| Price | 390 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98% by SDS-PAGE & gel filtration |
| Length [aa] | 182 |
| Molecular Weight | 19.5 kDa |
| N Terminal Sequence | AHPIP |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Not tested! |
| Species Reactivity | Bovine |
| Reconstitution | It is recommended to reconstitute the lyophilized bFGF-21 in 0.4% NaHCO3 or water, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar |
| Synonyms | Fibroblast Growth Factor-21, FGFL |
| Description | Bovine FGF-21 is a secreted growth factor that is a member of the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. Recombinant bovine FGF-21 is a 19.5 kDa protein containing 182 amino acid residues. |
| Protein Sequence | AHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAHLEIRADGTVVGAARQSPESLLELKALKPGVIQILGVKTSRFLCQGPDGKLYGSLHFDPKACSFRELLLEDGYNVYQSETLGLPLRLPPQRSSNRDPAPRGPARFLPLPGLPAAPPDPPGILAPEPPDVGSSDPLSMVGPSYGRSPSYTS |
| Uniprot ID | E1BDA6 |
| Protein RefSeq | XP_005219543.1 |
| mRNA RefSeq | XM_005219486.4 |
All prices plus VAT + possible delivery charges