Human FGF-4
Slide this table
| Cat-Nr. | 300-131 |
| Size | 25 µg |
| Price | 180 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 177 |
| Molecular Weight | 19.7 kDa |
| N Terminal Sequence | MAPTAPNGTL |
| Biological Activity | The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts). |
| Species Reactivity | Mouse, Rat, Human, Pig |
| Buffer | PBS |
| Reconstitution | We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use. |
| Stability and Storage | The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted FGF-4 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles. |
| Synonyms | FGF4; HST; KFGF; HST-1; HSTF1; K-FGF; HBGF-4 |
| Description | FGF-4 (fibroblast growth factor 4), also known as K-FGF (Kaposi’s sarcoma associated FGF), is a 25 kDa secreted, heparin binding member of the FGF family. The human FGF-4 cDNA encodes 206 amino acids (aa) with a 33 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C terminus. Mature human FGF-4 shares a high aa identity with mouse, rat, canine and bovine FGF-4, respectively. The expression of FGF-4 and its receptors, FGF-R1c, -R2c, -R3c and R4, is spatially and temporally regulated during embryonic development. Its expression in the mouse trophoblast inner cell mass promotes expression of FGF-R2, and is required for maintenance of the trophectoderm and primitive endoderm. FGF-4 is proposed to play a physiologically relevant role in human embryonic stem cell self-renewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in-vitro. FGF-4 is mitogenic for fibroblasts and endothelial cells in-vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in-vivo and has been investigated as therapy for coronary artery disease. |
| Protein Sequence | APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLP RL |
| Uniprot ID | P08620 |
| Protein RefSeq | NP_001998.1 |
| mRNA RefSeq | NM_002007 |
Figures
SDS-PAGE analysis of recombinant human FGF-4. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.
Dose-dependent stimulation of cell proliferation in NHDF cells by recombinant human FGF-4.
Reference
- dCas9 fusion to computer-designed PRC2 inhibitor reveals functional TATA box in distal promoter region. S. Levy et al., Cell Rep. 2022 Mar 1; 38(9): 110457.
- Induction of Rosette-to-Lumen stage embryoids using reprogramming paradigms in ESCs. J. Langkabel et al., Nat Commun. 2021; 12: 7322.
- Persistent Human KIT Receptor Signaling Disposes Murine Placenta to Premature Differentiation Resulting in Severely Disrupted Placental Structure and Functionality. F. Kaiser et al., Int J Mol Sci. 2020 Aug; 21(15): 5503.
- Derivation and Maintenance of Murine Trophoblast Stem Cells under Defined Conditions. C. Kubaczka et al., Stem Cell Reports. 2014 Feb 11; 2(2): 232–242.
All prices plus VAT + possible delivery charges