Human Prox-1 (fragment)
Slide this table
| Cat-Nr. | 300-052 |
| Size | 5 µg |
| Price | 120 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 192 |
| Molecular Weight | 22.35 kDa |
| Biological Activity | Control for Western Blotting. Biological activity not tested. |
| Species Reactivity | Human |
| Buffer | PBS |
| Reconstitution | Centrifuge vial prior to opening. The lyophilized Prox-1 should be reconstituted in water to a concentration not lower than 50 µg/ml. |
| Stability and Storage | The lyophilized protein is stable for a few weeks at room temperature, but best stored at –20°C. Reconstituted Prox-1 should be stored in working aliquots at –20°C. Avoid repeated freeze-thaw cycles. |
| Synonyms | PROX1; W117m |
| Description | Prox-1 is a homeobox gene and acts as a master switch for lymphatic endothelial phenotype. Expression of Prox-1 in blood endothelial cells induces expression of other lymphatic marker genes. Together with Podoplanin, Prox-1 can be used to reliably distinguish lympathic vessels from blood vessels. Prox1 is expressed in CNS, eye, pancreas, liver and heart, and it is one of the most specific and reliable markers for lymphatic endothelial cells. The highly conserved C-terminal part of the homeobox transcription factor Prox1 was produced in E. coli. It was not tested for activity and can be used as positive control e.g. in Western analysis. |
| Protein Sequence | MAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE |
| Uniprot ID | Q92786 |
| Protein RefSeq | NP_002754 |
| mRNA RefSeq | NM_002763 |
Figures
SDS-PAGE analysis of recombinant human Prox-1. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.
All prices plus VAT + possible delivery charges