Human PDGF-AB
Slide this table
Cat-Nr. | 200-053S |
Size | 2 µg |
Price | 65 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 126/110 |
Molecular Weight | 25.5 kDa |
Endotoxin Levels | < 0.1 ng per ug of PDGF-AB |
Biological Activity | The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts). |
Species Reactivity | Human |
Buffer | 50mM acetic acid |
Reconstitution | Centrifuge vial prior to opening. The lyophilized PDGF-AB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recommended. |
Stability and Storage | The lyophilized PDGF-AB is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-AB is best stored at -20°C to -70°C. Avoid repeated freeze-thaw cycles. |
Synonyms | PDGFA; PDGF1; PDGF-A |
Description | PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet α-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-α and PDGFR-β. PDGFR-α is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-β interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AB is a 25.5 kDa disulfide-linked dimer, consisting of one A chain and one B chains (234 total amino acids). |
Protein Sequence | Alpha chain: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT Beta chain: MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLGDHLACKCETVAAARPVT |
Uniprot ID | P04085/P01127 |
Protein RefSeq | NP_002599.1;NP_002598.3 |
mRNA RefSeq | NM_002608.2;NM_002607.6 |
Figures
All prices plus VAT + possible delivery charges