Human IL-3
Slide this table
| Cat-Nr. | 200-016 |
| Size | 10 µg |
| Price | 145 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | >98% by SDS-PAGE |
| Length [aa] | 134 |
| Molecular Weight | 15.0 kDa |
| N Terminal Sequence | MAPMTQT |
| Endotoxin Levels | < 0.1 ng per µg (IEU/µg) of rh IL-3 |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is < 0.1 – 0.5 ng/ml. The WHO standard #91/510 was used as a control. |
| Species Reactivity | Human |
| Buffer | PBS |
| Reconstitution | The lyophilized IL-3 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. |
| Stability and Storage | The lyophilized IL-3, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-3 should be stored in working aliquots at -20°C. |
| Synonyms | IL3; IL-3; MCGF; MULTI-CSF |
| Description | IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine. Recombinant human IL-3 is a 15.0 kDa globular protein containing 133 amino acid residues. |
| Protein Sequence | MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Uniprot ID | P08700 |
| Protein RefSeq | NP_000579 |
| mRNA RefSeq | NM_000588 |
Figures
SDS-PAGE analysis of recombinant human IL-3. Samples were loaded in 15% SDS-polyacrylamide gel under reducing conditions and visualized with Silver staining.
Proliferation assay with TF1 cells. The cells were stimulated using recombinant human IL-3 and the WHO standard 91/510. Values are the means (±SD) of triplicate determinations and expressed as percentage of control.
Reference
- Antileukemic potential of methylated indolequinone MAC681 through immunogenic necroptosis and PARP1 degradation. B. Orlikova-Boyer et al., Biomark Res. 2024; 12: 47.
- Sphingolipid-mediated inflammatory signaling leading to autophagy inhibition converts erythropoiesis to myelopoiesis in human hematopoietic stem/progenitor cells. M. Orsini et al., Cell Death Differ. 2019 Sep; 26(9): 1796–1812.
- Ex Vivo Expansion of Functional Human UCB-HSCs/HPCs by Coculture with AFT024-hkirre Cells. Muti ur Rehman Khan et al., Biomed Res Int. 2014; 2014: 412075.
- Cocultivation of umbilical cord blood CD34+ cells with retro-transduced hMSCs leads to effective amplification of long-term culture-initiating cells. Chun-Gang Xie et al., World J Gastroenterol. 2006 Jan 21; 12(3): 393–402.
- Cell surface sialylation and ecto-sialyltransferase activity of human CD34 progenitors from peripheral blood and bone marrow. Schwartz-Albiez R. et al., Glycoconj J. 2004;21(8-9):451-9.
All prices plus VAT + possible delivery charges