Human PTHrP
Slide this table
| Cat-Nr. | 100-275S |
| Size | 10 µg |
| Price | 95 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 86 |
| Molecular Weight | 9.8 kDa |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Data not available. |
| Species Reactivity | Human |
| Synonyms | Parathyroid Hormone-related Protein |
| Description | PTHrP is a polypeptide hormone produced by almost every tissue of the body. PTHrP is closely related to parathyroid hormone (PTH), which is secreted from the parathyroid gland, and plays a central role in regulating the extracellular concentrations of calcium and phosphorous. Recombinant human PTHrP is a 9.8 kDa linear polypeptide of 86 amino acid residues. |
| Protein Sequence | AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP |
| Uniprot ID | P12272 |
| Protein RefSeq | NP_002811.1 |
| mRNA RefSeq | NM_002820.2 |
All prices plus VAT + possible delivery charges