Human I-TAC (CXCL11)
Slide this table
Cat-Nr. | 100-058S |
Size | 5 µg |
Price | 95 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
Length [aa] | 73 |
Molecular Weight | 8.3 kDa |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Determined by its ability to chemoattract IL-2 activated T-cells using a concentration range of 0.1-10.0 ng/ml. |
Species Reactivity | Hamster, Mouse, Rabbit, Human, Monkey |
Synonyms | CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B |
Description | Human I-TAC (Interferon-inducible T cell alpha chemoacttractant) is an 8.3 kDa protein containing 73 amino acid residues. I-TAC is a novel non-ELR CXC chemokine. It is regulated by Interferon and has potent chemoattractant activity for IL-2 activated T cells, but not for freshly isolated unstimulated T cells, neutrophils, or monocytes. |
Protein Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
Uniprot ID | O14625 |
Protein RefSeq | NP_005400.1 |
mRNA RefSeq | NM_005409.4 |
All prices plus VAT + possible delivery charges