Human BAFF
Slide this table
| Cat-Nr. | 100-002 |
| Size | 20 µg |
| Price | 199 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 153 |
| Molecular Weight | 17.0 kDa |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Determined by its dose-dependent stimulation of IL-8 production by human PBMC. The ED50 for this effect is less than 10 ng/ml. |
| Species Reactivity | Human |
| Buffer | 0.5 x PBS pH 7.5 + 0.5 mM DTT |
| Synonyms | TNFSF13B; DTL; BAFF; BLYS; CD257; TALL1; THANK; ZTNF4; TALL-1; TNFSF20 |
| Description | BAFF, a member of the TNF family of ligands, is expressed in T cells, macrophages, monocytes and dendritic cells. BAFF is involved in stimulation of B and T cell function, and is an important survival and maturation factor for peripheral B cells. BAFF signals through three different TNF receptors TACI, BCMA and BAFF-R. The human BAFF gene codes for a 285 amino acid type II transmembrane protein containing a 46 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 218 amino acid extracellular domain. Recombinant human soluble BAFF is a 153 amino acid polypeptide (17.0 kDa), which contains the TNF-like portion of the extracellular domain of BAFF. |
| Protein Sequence | AVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL |
| Uniprot ID | Q9Y275 |
| Protein RefSeq | NP_006564.1 |
| mRNA RefSeq | NM_006573.4 |
Reference
- Increased B Cell-Activating Factor Promotes Tumor Invasion and Metastasis in Human Pancreatic Cancer. Mitsuhito Koizumi et al., PLoS One. 2013; 8(8): e71367.
All prices plus VAT + possible delivery charges