Human 4-1BBL
Slide this table
Cat-Nr. | 100-001 |
Size | 20 µg |
Price | 190 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 97% by SDS-PAGE & HPLC analyses |
Length [aa] | 185 |
Molecular Weight | 19.5 kDa |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Determined by the dose-dependent stimulation of IL-8 production by human PBMC. The expected ED50 for this effect is 5-10 ng/ml. NOTE: Results may vary with different PBMC donors. |
Species Reactivity | Human |
Synonyms | TNFSF9; CD137L; 4-1BB-L |
Description | 4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 205 amino acid extracellular domain. The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. Recombinant human 4-1BBL is a soluble 19.5 kDa protein consisting of 185 amino acid residues. |
Protein Sequence | MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Uniprot ID | P41273 |
Protein RefSeq | NP_003802.1 |
mRNA RefSeq | NM_003811.3 |
All prices plus VAT + possible delivery charges